Home » Archive by category "DEFAULT"

Verklärt Nacht


Download Verklärt Nacht



Sitemap

Hotel Happiness - Brook Benton - 20 Golden Hits (CD), White Silver Sands - Walter Vaughn - White Silver Sands / Going Down The Railroad Track (Vinyl), You Do - Aimee Mann - Bachelor Nº 2 - Or, The Last Remains Of The Dodo (CD, Album), Darkspace - Dark Space -I (File), Swingen - Ellen Fullman - The Long String Instrument (Vinyl, LP, Album), Youre Gonna Get It - Trance Dance - Youre Gonna Get It (Vinyl), Welcome Into My Dreams - Whispers* - In The Mood (Vinyl, LP), Easy Lee - Ludovic Vendi - Session 037 (File, MP3), Live In The Mix - Flow Dynamics - Live In The Mix (Vinyl), Remocons - Last Supper Show (CD), Sexy! No No No - LukHash - The Far End Of The World (File, MP3, Album), Hypocritical - Mangled (2) / Inseptulus - Most Painful Ways/ Stigma Of Soul (Cassette, Album), Primordial Will - Akashah - Barbarous (CD, Album), Steeled Blues - Jeff Beck - Beginnings (1964-1966) (CD)

Comments

  1. Tauzuru says:
    Verklärte Nacht, Op. 4, (English: “Transfigured Night”) string sextet for two violins, two violas, and two cellos by Austrian-born American composer Arnold Schoenberg that dates to , before he adopted the tone method of composition that became his signature. It is a highly romantic piece.
  2. Mak says:
    Verklärt Nacht: Companies, etc. Pressed By – AAV Regency – Credits Artwork – Jessica DeClerk; Notes Housed in jewel case with fold-out booklet. Barcode and Other Identifiers Matrix / Runout: AAV REGENCY kingstonorciheligh.asinvihysihamnalchkastpiberpemit.co P /5(9).
  3. Fenrihn says:
    Sep 21,  · Essay: Arnold Schoenberg’s Verklärte Nacht is a sextet for two violins, two violas and two cellos and was written but was not performed until Verklärte Nacht is only a single movement divided into either five parts or two sonatas, depending on interpretation. The piece is based on the poem Verklärte Nacht by Richard Dehmel from Weib und Welt (Woman and World).
  4. Mazurg says:
    willemszoon - Although nor English nor German is my native language I am so bold as to wonder if 'Transfigured Night' is an adequate translation of 'Verklärte Nacht'.In my view 'verklärt' means bliss or happiness. About Efraim Israel's joke 'verklarte Nacht': in my opinion shipwrecked is .
  5. JoJolrajas says:
    Verklärte Nacht, Op.4 (Schoenberg, Arnold) It is very unlikely that this work is public domain in the EU, or in any country where the copyright term is life-plus years. However, it is in the public domain in Canada (where IMSLP is hosted) and other countries where the term is life-plus years (such as China, Japan, Korea and many others.
  6. Mikabei says:
    Schoenberg arranged Verklärte Nacht for string orchestra in and again in , adding a part for double bass, varying the texture between ensemble and solos, and inserting tempo and accent markings. The first recording was in by the Minneapolis Orchestra conducted by Eugene Ormandy.
  7. Goltitilar says:
    Verklärte Nacht is a moment of promise before all of this happens. Its emotional twists and turns carry in seed, in microcosm, the storms to come. And perhaps what remains scandalous about this work is the utopian optimism that we will arrive on the peaceful shore of D major, carried by the transforming power of love. Recording Notes.
  8. Jurg says:
    Verklärte Nacht (Transfigured Night). Str. sextet (2 vn., 2 va., 2 vc.) Op.4, by Schoenberg, based on poem by Richard Dehmel (from Weib und Welt). Comp. F.p.
  9. Mausida says:
    Verklärte Nacht Richard Dehmel. Zwei Menschen gehn durch kahlen, kalten Hain; der Mond läuft mit, sie schaun hinein. Der Mond läuft über hohe Eichen; kein Wölkchen trübt das Himmelslicht, in das die schwarzen Zacken reichen. Die Stimme eines Weibes spricht: Ich trag ein Kind, und nit von Dir, ich geh in Sünde neben Dir.

Leave a Reply

Your email address will not be published. Required fields are marked *

*
*